{"product_id":"proteintech-67173-1-ig","title":"Proteintech, 67173-1-Ig, HSPA4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPA4 (67173-1-Ig) by Proteintech is a Monoclonal antibody targeting HSPA4 in WB, ELISA applications with reactivity to human, pig samples\n67173-1-Ig targets HSPA4 in WB, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  pig brain tissue,  HepG2 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (Hsp 110) subfamily of Hsp70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16624 Product name: Recombinant human HSPA4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 680-840 aa of BC110861 Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID Predict reactive species\nFull Name: heat shock 70kDa protein 4\nCalculated Molecular Weight: 840 aa, 94 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC110861\nGene Symbol: HSPA4\nGene ID (NCBI): 3308\nRRID: AB_2882469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P34932\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888284094633,"sku":"67173-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67173-1-ig","provider":"Iright","version":"1.0","type":"link"}