{"product_id":"proteintech-67176-1-ig","title":"Proteintech, 67176-1-Ig, DMC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DMC1 (67176-1-Ig) by Proteintech is a Monoclonal antibody targeting DMC1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n67176-1-Ig targets DMC1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  human testis tissue,  rat testis,  mouse testis\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6951 Product name: Recombinant human DMC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC035658 Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL Predict reactive species\nFull Name: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)\nCalculated Molecular Weight: 165 aa, 18 kDa, 38 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC035658\nGene Symbol: DMC1\nGene ID (NCBI): 11144\nRRID: AB_2882472\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14565\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887973453993,"sku":"67176-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67176-1-ig","provider":"Iright","version":"1.0","type":"link"}