{"product_id":"proteintech-67196-1-ig","title":"Proteintech, 67196-1-Ig, YES1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe YES1 (67196-1-Ig) by Proteintech is a Monoclonal antibody targeting YES1 in WB, IHC, ELISA applications with reactivity to Human, rat samples\n67196-1-Ig targets YES1 in WB, IHC, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  HeLa cells,  LNCaP cells,  A431 cells,  HSC-T6 cells,  PC-12 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily.  It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP\/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5016 Product name: Recombinant human YES1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-526 aa of BC048960 Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL Predict reactive species\nFull Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC048960\nGene Symbol: YES1\nGene ID (NCBI): 7525\nRRID: AB_2918483\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P07947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888080507049,"sku":"67196-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67196-1-ig","provider":"Iright","version":"1.0","type":"link"}