{"product_id":"proteintech-67210-1-ig","title":"Proteintech, 67210-1-Ig, WNT10B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT10B (67210-1-Ig) by Proteintech is a Monoclonal antibody targeting WNT10B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n67210-1-Ig targets WNT10B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCCIT cells, MCF-7 cells,  NCI-H1299 cells,  human heart tissue,  pig heart tissue,  rat heart tissue,  mouse heart tissue\nPositive IHC detected in: mouse liver tissue, mouse skeletal muscle tissue,  human heart tissue,  mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWnt10b is a member of the Wnt ligand gene family that encodes for secreted proteins, which activate the ancient and highly conserved Wnt signalling cascade. This antibody can be detected a band of 43 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17114 Product name: Recombinant human WNT10B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-204 aa of BC096353 Sequence: FLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMD Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 10B\nCalculated Molecular Weight: 389 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC096353\nGene Symbol: WNT10B\nGene ID (NCBI): 7480\nRRID: AB_2882503\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00744\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888013496489,"sku":"67210-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67210-1-ig","provider":"Iright","version":"1.0","type":"link"}