{"product_id":"proteintech-67212-1-ig","title":"Proteintech, 67212-1-Ig, CDC42 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC42 (67212-1-Ig) by Proteintech is a Monoclonal antibody targeting CDC42 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67212-1-Ig targets CDC42 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat brain tissue,  mouse cerebellum tissue,  HEK-293 cells,  MCF-7 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho\/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28550 Product name: Recombinant human CDC42 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC002711 Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR Predict reactive species\nFull Name: cell division cycle 42 (GTP binding protein, 25kDa)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC002711\nGene Symbol: CDC42\nGene ID (NCBI): 998\nRRID: AB_2918484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P60953\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888058290345,"sku":"67212-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67212-1-ig","provider":"Iright","version":"1.0","type":"link"}