{"product_id":"proteintech-67213-1-ig","title":"Proteintech, 67213-1-Ig, RHOQ\/TC10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOQ\/TC10 (67213-1-Ig) by Proteintech is a Monoclonal antibody targeting RHOQ\/TC10 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig samples\n67213-1-Ig targets RHOQ\/TC10 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse brain tissue,  rat brain tissue,  pig brain tissue,  fetal human brain tissue,  Jurkat cells,  A549 cells\nPositive IHC detected in: mouse liver tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:8000-1:32000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12078 Product name: Recombinant human RHOQ protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-205 aa of BC070485 Sequence: MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT Predict reactive species\nFull Name: ras homolog gene family, member Q\nCalculated Molecular Weight: 205 aa, 23 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC070485\nGene Symbol: RHOQ\/TC10\nGene ID (NCBI): 23433\nRRID: AB_2882505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P17081\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888319090857,"sku":"67213-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67213-1-ig","provider":"Iright","version":"1.0","type":"link"}