{"product_id":"proteintech-67219-1-ig","title":"Proteintech, 67219-1-Ig, VAMP4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAMP4 (67219-1-Ig) by Proteintech is a Monoclonal antibody targeting VAMP4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67219-1-Ig targets VAMP4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  K-562 cells,  pig brain tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAMP4 is a member of the vesicle-associated membrane protein (VAMP)\/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP4 may play a role in trans-Golgi network to endosome transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27854 Product name: Recombinant human VAMP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC007019 Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT Predict reactive species\nFull Name: vesicle-associated membrane protein 4\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC007019\nGene Symbol: VAMP4\nGene ID (NCBI): 8674\nRRID: AB_2882510\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888079982761,"sku":"67219-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67219-1-ig","provider":"Iright","version":"1.0","type":"link"}