{"product_id":"proteintech-67221-1-ig","title":"Proteintech, 67221-1-Ig, SLC31A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC31A1 (67221-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC31A1 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n67221-1-Ig targets SLC31A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28410 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species\nFull Name: solute carrier family 31 (copper transporters), member 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC013611\nGene Symbol: SLC31A1\nGene ID (NCBI): 1317\nRRID: AB_2882512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15431\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887988068521,"sku":"67221-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67221-1-ig","provider":"Iright","version":"1.0","type":"link"}