{"product_id":"proteintech-67241-1-ig","title":"Proteintech, 67241-1-Ig, Thrombospondin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Thrombospondin 1 (67241-1-Ig) by Proteintech is a Monoclonal antibody targeting Thrombospondin 1 in WB, ELISA applications with reactivity to Human, rat, mouse samples\n67241-1-Ig targets Thrombospondin 1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, rat spleen tissue,  NIH\/3T3 cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThrombospondin 1(TSP-1), an extracellular matrix protein, is the first identified natural angiogenesis inhibitor. A variety of normal cells, including endothelial cells, fibroblasts, adipocytes, smooth muscle cells, monocytes, macrophages, and transformed cells such as malignant glioma cells, secrete Thrombospondin 1. It regulates cellular phenotype during tissue genesis and repair. It acts as a molecular facilitator by bringing together cytokines, growth factors, matrix components, membrane receptors and extracellular proteases. Thrombospondin 1 binds to a wide variety of integrin and non-integrin cell surface receptors. It is also a major activator of transforming growth factor (TGFβ1). Secreted TSP1 is a glycoprotein with a molecular mass of 150-180 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29129 Product name: Recombinant human THBS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-250 aa of NM_003246 Sequence: GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS Predict reactive species\nFull Name: thrombospondin 1\nCalculated Molecular Weight: 129 kDa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_003246\nGene Symbol: Thrombospondin 1\nGene ID (NCBI): 7057\nRRID: AB_2882520\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P07996\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888034140329,"sku":"67241-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67241-1-ig","provider":"Iright","version":"1.0","type":"link"}