{"product_id":"proteintech-67255-1-ig","title":"Proteintech, 67255-1-Ig, Nanog Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Nanog (67255-1-Ig) by Proteintech is a Monoclonal antibody targeting Nanog in WB, ELISA applications with reactivity to human samples\n67255-1-Ig targets Nanog in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HuH-7 cells,  MDA-MB-231 cells,  MCF-7 cells,  T-47D cells,  NCCIT cells,  JAR cells,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNanog is a member of the homeobox family of DNA binding transcription factors and has been shown to maintain embryonic stem (ES) cell self-renewal independently of leukemia inhibitory factor (LIF)\/Stat3. Nanog mRNA is present in pluripotent mouse and human cell lines, and absent from differentiated cells. Functionally, Nanog works together with other key pluripotent factors (Oct4, Sox2, and Lin28) to reprogram human fibroblasts and generate induced pluripotent stem (iPS) cells. These key factors form a regulatory network to support or limit each other's expression level, which maintains the properties of ES cells. Affinity purified rabbit anti-Nanog can be used to demonstrate pluripotency of ES and IPS cells. There are two kinds of variants could recognized by NANOG, one is normal form (~39kd), the other is post-translation modified form (~48kd) (21136380 ). Nanog exists two isoforms with molecular weight 34.4 kDa and 31.9 kDa. (PMID: 21969378)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21364 Product name: Recombinant human NANOG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC160187 Sequence: MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV Predict reactive species\nFull Name: Nanog homeobox\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC160187\nGene Symbol: Nanog\nGene ID (NCBI): 79923\nRRID: AB_2882529\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H9S0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887986266281,"sku":"67255-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67255-1-ig","provider":"Iright","version":"1.0","type":"link"}