{"product_id":"proteintech-67268-1-ig","title":"Proteintech, 67268-1-Ig, TRIM9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM9 (67268-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM9 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples\n67268-1-Ig targets TRIM9 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat brain tissue,  mouse brain tissue\nPositive IHC detected in: rat brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM9(E3 ubiquitin-protein ligase TRIM9) is also named as RNF91 and belongs to the TRIM\/RBCC family. TRIM9 protein is a brain-specific E3 ubiquitin ligase. Importantly, TRIM9 is present in LBs found in DLB and PD, suggesting that TRIM9 not only plays roles in the regulation of neuronal functions, but also participates in the formation or breakdown of abnormal inclusions through its ligase activity and besides the striatum and hippocampus, the highest expression of TRIM9 protein is seen in the frontal, temporal and occipital cortices through the western blot (PMID:20085810). It has been reported that TRIM9 is highly expressed in the cerebral cortex in mouse and human brains and that TRIM9 is decreased in damaged brains in patients who have Parkinson disease and dementia with Lewy bodies(PMID:22337885). It has 3 isoforms with molecular mass of 79, 90 and 61 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat, Pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27856 Product name: Recombinant human TRIM9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC013414 Sequence: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVR Predict reactive species\nFull Name: tripartite motif-containing 9\nCalculated Molecular Weight: 80 kDa\nObserved Molecular Weight: 90 kDa, 79 kDa, 61 kDa\nGenBank Accession Number: BC013414\nGene Symbol: TRIM9\nGene ID (NCBI): 114088\nRRID: AB_2882538\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9C026\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332951721,"sku":"67268-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67268-1-ig","provider":"Iright","version":"1.0","type":"link"}