{"product_id":"proteintech-67274-1-ig","title":"Proteintech, 67274-1-Ig, WWP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe WWP2 (67274-1-Ig) by Proteintech is a Monoclonal antibody targeting WWP2 in WB, IHC, ELISA applications with reactivity to Human, Rat samples\n67274-1-Ig targets WWP2 in WB, IHC, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, LNCap cells,  MCF-7 cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWWP2 (WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes (PMID:21532586). WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells (PMID:15047715).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2835 Product name: Recombinant human WWP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC013645 Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT Predict reactive species\nFull Name: WW domain containing E3 ubiquitin protein ligase 2\nCalculated Molecular Weight: 870 aa, 99 kDa\nObserved Molecular Weight: 100-115 kDa\nGenBank Accession Number: BC013645\nGene Symbol: WWP2\nGene ID (NCBI): 11060\nRRID: AB_2882543\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00308\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888051572905,"sku":"67274-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67274-1-ig","provider":"Iright","version":"1.0","type":"link"}