{"product_id":"proteintech-67320-1-ig","title":"Proteintech, 67320-1-Ig, ARPC1B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPC1B (67320-1-Ig) by Proteintech is a Monoclonal antibody targeting ARPC1B in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples\n67320-1-Ig targets ARPC1B in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells,  THP-1 cells,  rat spleen tissues\nPositive IHC detected in: human appendicitis tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2\/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29095 Product name: Recombinant human ARPC1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 265-372 aa of BC007555 Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK Predict reactive species\nFull Name: actin related protein 2\/3 complex, subunit 1B, 41kDa\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC007555\nGene Symbol: ARPC1B\nGene ID (NCBI): 10095\nRRID: AB_2882580\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15143\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888100266153,"sku":"67320-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67320-1-ig","provider":"Iright","version":"1.0","type":"link"}