{"product_id":"proteintech-67338-1-ig","title":"Proteintech, 67338-1-Ig, PSMD9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMD9 (67338-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMD9 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67338-1-Ig targets PSMD9 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  NIH\/3T3 cells,  HSC-T6 cells,  K-562 cells,  Jurkat cells,  LNCaP cells,  HeLa cells,  4T1 cells,  HepG2 cells\nPositive IF\/ICC detected in: U2OS cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25654 Product name: Recombinant human PSMD9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-102 aa of BC004213 Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 9\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC004213\nGene Symbol: PSMD9\nGene ID (NCBI): 5715\nRRID: AB_2882596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888048525481,"sku":"67338-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67338-1-ig","provider":"Iright","version":"1.0","type":"link"}