{"product_id":"proteintech-67349-1-ig","title":"Proteintech, 67349-1-Ig, SRY Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRY (67349-1-Ig) by Proteintech is a Monoclonal antibody targeting SRY in WB, ELISA applications with reactivity to human, rat samples\n67349-1-Ig targets SRY in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSRY (sex-determining region Y protein) is a tran-scriptional activator required for male sex determination in mammals. This protein, also referred to as testis-determining factor (TDF), is an HMG box protein that initiates the formation of testis from undifferentiated gonad. The DNA-binding activity of SRY is required for normal testis formation. This DNA-binding activity is thought to be regulated by PKA, which phosphorylates SRY in vivo. Mutations in SRY have been associated with 46,XY gonadal dysgenesis, in which the gonads fail to develop in XY phenotypic females.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12610 Product name: Recombinant human SRY protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC074924 Sequence: MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL Predict reactive species\nFull Name: sex determining region Y\nCalculated Molecular Weight: 204 aa, 24 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC074924\nGene Symbol: SRY\nGene ID (NCBI): 6736\nRRID: AB_2882607\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q05066\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888076607657,"sku":"67349-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67349-1-ig","provider":"Iright","version":"1.0","type":"link"}