{"product_id":"proteintech-67363-1-ig","title":"Proteintech, 67363-1-Ig, NHE1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHE1 (67363-1-Ig) by Proteintech is a Monoclonal antibody targeting NHE1 in WB, ELISA applications with reactivity to human, rat samples\n67363-1-Ig targets NHE1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, NCI-H1299 cells,  HEK-293 cells,  LNCaP cells,  Jurkat cells,  HSC-T6 cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHE1, also named as SLC9A1, is involved in pH regulation that can eliminate acids generated by active metabolism and counter adverse environmental conditions. NHE1 plays an important role in signal transduction. It has been shown that NHE1 participates in the development and progression of human breast cancer, gastric cancer and others. NHE1 has some isoforms with 91 kDa , 110 kDa (phosphoglycoprotein) and 210 kDa (dimeric protein). (PMID:28098891, 27751915, 8300588)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14329 Product name: Recombinant human NHE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 1\nCalculated Molecular Weight: 815 aa, 91 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC012121\nGene Symbol: NHE1\nGene ID (NCBI): 6548\nRRID: AB_2882615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P19634\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888004190377,"sku":"67363-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67363-1-ig","provider":"Iright","version":"1.0","type":"link"}