{"product_id":"proteintech-67364-1-ig","title":"Proteintech, 67364-1-Ig, HDAC9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC9 (67364-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC9 in WB, ELISA applications with reactivity to human samples\n67364-1-Ig targets HDAC9 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Daudi cells,  HepG2 cells,  Raji cells,  K-562 cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle and testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species\nFull Name: histone deacetylase 9\nCalculated Molecular Weight: 1011 aa, 111 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC152405\nGene Symbol: HDAC9\nGene ID (NCBI): 9734\nRRID: AB_2882616\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UKV0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888020541609,"sku":"67364-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67364-1-ig","provider":"Iright","version":"1.0","type":"link"}