{"product_id":"proteintech-67392-1-ig","title":"Proteintech, 67392-1-Ig, PPP4R1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP4R1 (67392-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP4R1 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67392-1-Ig targets PPP4R1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  Jurkat cells,  HSC-T6 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue, mouse liver tissue\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26750 Product name: Recombinant human PPP4R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 331-520 aa of BC060829 Sequence: NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS Predict reactive species\nFull Name: protein phosphatase 4, regulatory subunit 1\nCalculated Molecular Weight: 107 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC060829\nGene Symbol: PPP4R1\nGene ID (NCBI): 9989\nRRID: AB_2882636\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8TF05\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888071757993,"sku":"67392-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67392-1-ig","provider":"Iright","version":"1.0","type":"link"}