{"product_id":"proteintech-67397-1-ig","title":"Proteintech, 67397-1-Ig, SEMA7A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEMA7A (67397-1-Ig) by Proteintech is a Monoclonal antibody targeting SEMA7A in WB, ELISA applications with reactivity to Human samples\n67397-1-Ig targets SEMA7A in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human red blood cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEMA7A, also named  CD108 and SEMAL, belongs to the semaphorin family. SEMA7A is the only membrane‐associated glycosylphosphatidylinositol (GPI)‐linked semaphorin and plays a role in the regulation of neuronal axon outgrowth. In addition to its role in guiding axon pathfinding during neuronal development, Sema7A has diverse functions in morphogenesis and immune cell control and regulates T cell responses via the α1β1 integrin receptor (PMID: 31179640). SEMA7A has 2 isoforms with molecular weights of  73 and 75 kDa, respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28804 Product name: Recombinant human SEMA7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 371-423 aa of BC101643 Sequence: QPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGET Predict reactive species\nFull Name: semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)\nCalculated Molecular Weight: 666 aa, 75 kDa\nObserved Molecular Weight: 75-80 kDa\nGenBank Accession Number: BC101643\nGene Symbol: SEMA7A\nGene ID (NCBI): 8482\nRRID: AB_2882640\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75326\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888075002025,"sku":"67397-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67397-1-ig","provider":"Iright","version":"1.0","type":"link"}