{"product_id":"proteintech-67420-1-ig","title":"Proteintech, 67420-1-Ig, RBM39 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM39 (67420-1-Ig) by Proteintech is a Monoclonal antibody targeting RBM39 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67420-1-Ig targets RBM39 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HeLa cells,  LNCaP cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  Neuro-2a cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1\/ER-alpha and ESR2\/ER-beta, and JUN\/AP-1. RBM39 may be involved in pre-mRNA splicing process.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15766 Product name: Recombinant human RBM39 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 328-530 aa of BC141835 Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR Predict reactive species\nFull Name: RNA binding motif protein 39\nCalculated Molecular Weight: 530 aa, 59 kDa\nObserved Molecular Weight: 60-66 kDa\nGenBank Accession Number: BC141835\nGene Symbol: RBM39\nGene ID (NCBI): 9584\nRRID: AB_2882660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14498\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888318009513,"sku":"67420-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67420-1-ig","provider":"Iright","version":"1.0","type":"link"}