{"product_id":"proteintech-67427-1-ig","title":"Proteintech, 67427-1-Ig, KLK11 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLK11 (67427-1-Ig) by Proteintech is a Monoclonal antibody targeting KLK11 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n67427-1-Ig targets KLK11 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TT cells, DU 145 cells,  pig brain tissue,  LNCaP cells,  PC-3 cells,  Jurkat cells,  rat brain tissue,  A431 cells,  HaCaT cells,  HT-29 cells,  SW 1990 cells,  mouse brain tissue,  rat skin tissue\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29895 Product name: Recombinant human KLK11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 58-250 aa of BC022068 Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN Predict reactive species\nFull Name: kallikrein-related peptidase 11\nCalculated Molecular Weight: 250 aa, 27 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC022068\nGene Symbol: KLK11\nGene ID (NCBI): 11012\nRRID: AB_2882666\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UBX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888044036265,"sku":"67427-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67427-1-ig","provider":"Iright","version":"1.0","type":"link"}