{"product_id":"proteintech-67430-1-ig","title":"Proteintech, 67430-1-Ig, AMPD2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMPD2 (67430-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67430-1-Ig targets AMPD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, 4T1 cells,  HeLa cells,  HepG2 cells,  L02 cells,  Neuro-2a cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:20000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdenosine monophosphate deaminase (AMPD) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle. Three AMPDs are present in mammals named AMPD1\/2\/3. AMPD2 is the main activity present in adult human liver and is widely expressed in non-muscle tissues and cells (PMID: 8526848). AMPD2 has some isoforms with the molecular mass of 88-101 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8433 Product name: Recombinant human AMPD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 448-798 aa of BC007711 Sequence: LEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ Predict reactive species\nFull Name: adenosine monophosphate deaminase 2 (isoform L)\nCalculated Molecular Weight: 879aa,101 kDa; 798aa,92 kDa\nObserved Molecular Weight: 101 kDa\nGenBank Accession Number: BC007711\nGene Symbol: AMPD2\nGene ID (NCBI): 271\nRRID: AB_2882668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q01433\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888087093417,"sku":"67430-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67430-1-ig","provider":"Iright","version":"1.0","type":"link"}