{"product_id":"proteintech-67439-1-ig","title":"Proteintech, 67439-1-Ig, SOX9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX9 (67439-1-Ig) by Proteintech is a Monoclonal antibody targeting SOX9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples\n67439-1-Ig targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, Caco-2 cells,  human placenta tissue,  NCCIT cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining\nregion Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, rabbit, canine\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28620 Product name: Recombinant human SOX9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 209-509 aa of BC007951 Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP Predict reactive species\nFull Name: SRY (sex determining region Y)-box 9\nCalculated Molecular Weight: 509 aa, 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC007951\nGene Symbol: SOX9\nGene ID (NCBI): 6662\nRRID: AB_2882675\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P48436\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887974895785,"sku":"67439-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67439-1-ig","provider":"Iright","version":"1.0","type":"link"}