{"product_id":"proteintech-67449-1-ig","title":"Proteintech, 67449-1-Ig, OMA1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe OMA1 (67449-1-Ig) by Proteintech is a Monoclonal antibody targeting OMA1 in WB, ELISA applications with reactivity to Human, Mouse samples\n67449-1-Ig targets OMA1 in WB, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HeLa cells,  Jurkat cells,  LNCaP cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOMA1(Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1(Metalloprotease-related protein 1) and belongs to the peptidase M48 family.It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants,and the 40 kDa form of OMA1 may be the inactive form, with the 60 kDa form being the active enzyme(PMID:20334834)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11201 Product name: Recombinant human OMA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 361-524 aa of BC012915 Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS Predict reactive species\nFull Name: OMA1 homolog, zinc metallopeptidase (S. cerevisiae)\nCalculated Molecular Weight: 524 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC012915\nGene Symbol: OMA1\nGene ID (NCBI): 115209\nRRID: AB_2882683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96E52\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888046985385,"sku":"67449-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67449-1-ig","provider":"Iright","version":"1.0","type":"link"}