{"product_id":"proteintech-67451-1-ig","title":"Proteintech, 67451-1-Ig, TAOK3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAOK3 (67451-1-Ig) by Proteintech is a Monoclonal antibody targeting TAOK3 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n67451-1-Ig targets TAOK3 in WB, IHC, IF\/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  A549 cells,  LNCaP cells,  K-562 cells\nPositive IHC detected in: human prostate cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human prostate cancer tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAOK3(Serine\/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18 and belongs to the STE Ser\/Thr protein kinase family. It acts as an activator of the p38\/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2\/M transition DNA damage checkpoint by activating the p38\/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. And this protein can be autophosphorylated(PMID:20949042).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29146 Product name: Recombinant human TAOK3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 366-430 aa of BC002756 Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR Predict reactive species\nFull Name: TAO kinase 3\nCalculated Molecular Weight: 105 kDa\nObserved Molecular Weight: 100-105 kDa\nGenBank Accession Number: BC002756\nGene Symbol: TAOK3\nGene ID (NCBI): 51347\nRRID: AB_2882685\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H2K8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888077197481,"sku":"67451-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67451-1-ig","provider":"Iright","version":"1.0","type":"link"}