{"product_id":"proteintech-67471-1-ig","title":"Proteintech, 67471-1-Ig, PLCL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLCL2 (67471-1-Ig) by Proteintech is a Monoclonal antibody targeting PLCL2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n67471-1-Ig targets PLCL2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLCL2, a novel phospholipase C-like protein, is expressed in lymphocytes and platelets. The expression of PLCL2 is associated with the proliferation of mature B cells in the immune system. PLCL2 is a new susceptibility loci for myocardial infarction. It has been shown that PLCL2 plays a key role in the pathogenesis of atherosclerosis and systemic sclerosisit. There are three isoforms of PLCL2 protein and 67471-1-Ig antibody detects the 126 kDa band in SDS-PAGE. (PMID: 24916648, 25880423)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11461 Product name: Recombinant human PLCL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 653-1001 aa of BC036392 Sequence: VDPYVYVEIHGIPADCAEQRTKTVHQNGDAHIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPRKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE Predict reactive species\nFull Name: phospholipase C-like 2\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 126 kDa\nGenBank Accession Number: BC036392\nGene Symbol: PLCL2\nGene ID (NCBI): 23228\nRRID: AB_2882700\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UPR0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888311292073,"sku":"67471-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67471-1-ig","provider":"Iright","version":"1.0","type":"link"}