{"product_id":"proteintech-67477-1-ig","title":"Proteintech, 67477-1-Ig, ERAP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERAP2 (67477-1-Ig) by Proteintech is a Monoclonal antibody targeting ERAP2 in WB, ELISA applications with reactivity to Human, Rat samples\n67477-1-Ig targets ERAP2 in WB, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  HSC-T6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERAP2(Endoplasmic reticulum aminopeptidase 2) is also named as LRAP(Leukocyte-derived arginine aminopeptidase). It plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. ERAP2 can form heterodimers with ERAP1(PMID:15908954). Defects in the expression of ERAP2 may cause improper antigen processing, possibly leading to favor tumor escape from the immune surveillance. ERAP2 has the calculated molecular mass of 105-110 kDa, and apparent molecular mass of 120 kDa duo to the glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30061 Product name: Recombinant human ERAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 41-180 aa of BC065240 Sequence: PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY Predict reactive species\nFull Name: endoplasmic reticulum aminopeptidase 2\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC065240\nGene Symbol: ERAP2\nGene ID (NCBI): 64167\nRRID: AB_2882704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6P179\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041250985,"sku":"67477-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67477-1-ig","provider":"Iright","version":"1.0","type":"link"}