{"product_id":"proteintech-67479-1-ig","title":"Proteintech, 67479-1-Ig, SLC22A7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A7 (67479-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC22A7 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n67479-1-Ig targets SLC22A7 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SMMC-7721 cells\nPositive IHC detected in: human liver tissue, human liver cancer tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOrganic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25234 Product name: Recombinant human SLC22A7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species\nFull Name: solute carrier family 22 (organic anion transporter), member 7\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC033805\nGene Symbol: SLC22A7\nGene ID (NCBI): 10864\nRRID: AB_2882706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y694\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324268201,"sku":"67479-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67479-1-ig","provider":"Iright","version":"1.0","type":"link"}