{"product_id":"proteintech-67503-1-ig","title":"Proteintech, 67503-1-Ig, CDK5R1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDK5R1 (67503-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK5R1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples\n67503-1-Ig targets CDK5R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cerebellum tissue, pig brain tissue,  rat brain tissue,  mouse brain tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine\/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine\/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13152 Product name: Recombinant human CDK5R1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-307 aa of BC020580 Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Predict reactive species\nFull Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC020580\nGene Symbol: CDK5R1\nGene ID (NCBI): 8851\nRRID: AB_2882727\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15078\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888009826473,"sku":"67503-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67503-1-ig","provider":"Iright","version":"1.0","type":"link"}