{"product_id":"proteintech-67506-1-ig","title":"Proteintech, 67506-1-Ig, RBM15B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM15B (67506-1-Ig) by Proteintech is a Monoclonal antibody targeting RBM15B in WB, IHC, ELISA applications with reactivity to human, rat samples\n67506-1-Ig targets RBM15B in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  K-562 cells,  COLO 320 cells,  LNCaP cells,  HEK-293 cells,  Jurkat cells,  THP-1 cells\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17853 Product name: Recombinant human RBM15B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 490-769 aa of BC001367 Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL Predict reactive species\nFull Name: RNA binding motif protein 15B\nCalculated Molecular Weight: 890 aa, 97 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC001367\nGene Symbol: RBM15B\nGene ID (NCBI): 29890\nRRID: AB_2882729\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8NDT2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888048885929,"sku":"67506-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67506-1-ig","provider":"Iright","version":"1.0","type":"link"}