{"product_id":"proteintech-67513-1-ig","title":"Proteintech, 67513-1-Ig, PER2 (isoform 1) Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PER2 (isoform 1) (67513-1-Ig) by Proteintech is a Monoclonal antibody targeting PER2 (isoform 1) in WB, IF\/ICC, ELISA applications with reactivity to human samples\n67513-1-Ig targets PER2 (isoform 1) in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells,  Y79 cells,  BxPC-3 cells,  K-562 cells,  HL-60 cells,  THP-1 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29489 Product name: Recombinant human PER2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 740-839 aa of NM_022817 Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS Predict reactive species\nFull Name: period homolog 2 (Drosophila)\nCalculated Molecular Weight: 137 kDa\nObserved Molecular Weight: 150~160 kDa\nGenBank Accession Number: NM_022817\nGene Symbol: PER2\nGene ID (NCBI): 8864\nRRID: AB_2882734\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15055\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887989674153,"sku":"67513-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67513-1-ig","provider":"Iright","version":"1.0","type":"link"}