{"product_id":"proteintech-67525-1-ig","title":"Proteintech, 67525-1-Ig, IPO7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IPO7 (67525-1-Ig) by Proteintech is a Monoclonal antibody targeting IPO7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n67525-1-Ig targets IPO7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  U2OS cells,  LNCaP cells,  HeLa cells,  HepG2 cells,  K-562 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27257 Product name: Recombinant human IPO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 879-1016 aa of NM_006391.2 Sequence: MHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGG Predict reactive species\nFull Name: importin 7\nCalculated Molecular Weight: 120 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: NM_006391.2\nGene Symbol: IPO7\nGene ID (NCBI): 10527\nRRID: AB_2882745\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O95373\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888066056361,"sku":"67525-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67525-1-ig","provider":"Iright","version":"1.0","type":"link"}