{"product_id":"proteintech-67535-1-ig","title":"Proteintech, 67535-1-Ig, TIM23 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIM23 (67535-1-Ig) by Proteintech is a Monoclonal antibody targeting TIM23 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67535-1-Ig targets TIM23 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, RAW 264.7 cells,  HeLa cells,  MCF-7 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTim23 is a mitochondrial inner membrane protein essential for import of preproteins into the matrix. Tim23 together with Tim17 and Tim44 form the Tim23 complex which mediates the import of nuclear encoded preproteins into the mitochondria. Tim23 is commonly used as loading control for mitochondrial inner membrane protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27069 Product name: Recombinant human Tim23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-208 aa of BC062707 Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFIPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 23\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC062707\nGene Symbol: TIMM23\nGene ID (NCBI): 100287932\nRRID: AB_2882754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14925\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887997276329,"sku":"67535-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67535-1-ig","provider":"Iright","version":"1.0","type":"link"}