{"product_id":"proteintech-67573-1-ig","title":"Proteintech, 67573-1-Ig, Serpin A12\/Vaspin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Serpin A12\/Vaspin (67573-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin A12\/Vaspin in WB, IF\/ICC, ELISA applications with reactivity to human samples\n67573-1-Ig targets Serpin A12\/Vaspin in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human adipose tissue, human placenta tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30136 Product name: Recombinant human SERPINA12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-370 aa of BC040857 Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG Predict reactive species\nFull Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12\nCalculated Molecular Weight: 414 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC040857\nGene Symbol: Vaspin\nGene ID (NCBI): 145264\nRRID: AB_2882786\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IW75\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888322695337,"sku":"67573-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67573-1-ig","provider":"Iright","version":"1.0","type":"link"}