{"product_id":"proteintech-67584-1-ig","title":"Proteintech, 67584-1-Ig, PTP4A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTP4A1 (67584-1-Ig) by Proteintech is a Monoclonal antibody targeting PTP4A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n67584-1-Ig targets PTP4A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, Jurkat cells,  HeLa cells,  HepG2 cells,  HEK-293 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTP4A1(protein tyrosine phosphatase type IVA, member 1), also named as PRL1, HH72, PRL-1, PTP(CAAX1), PTPCAAX1, DKFZp779M0721, belongs to the protein-tyrosine phosphatase family, which play an important role in maintaining appropriate tyrosine phosphorylation levels in the cell during development and tissue regeneration (PMID:19341304). PTP4A1 is a PTPase and that it is highly expressed in growing hepatic cells and some tumor cell lines and is located primarily in the cell nucleus, and its overexpression modulates the growth of cells (PMID:8196618). PTP4A1 can exist as dimer, trimer and higher oligomers in vivo (PMID: 15571731, 18224294).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14436 Product name: Recombinant human PTP4A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-173 aa of BC023975 Sequence: MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ Predict reactive species\nFull Name: protein tyrosine phosphatase type IVA, member 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC023975\nGene Symbol: PTP4A1\nGene ID (NCBI): 7803\nRRID: AB_2923632\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q93096\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888315617449,"sku":"67584-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67584-1-ig","provider":"Iright","version":"1.0","type":"link"}