{"product_id":"proteintech-67590-1-ig","title":"Proteintech, 67590-1-Ig, VPS18 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VPS18 (67590-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS18 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Rat samples\n67590-1-Ig targets VPS18 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking\/fusion reactions of late endosomes\/lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29954 Product name: Recombinant human VPS18 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species\nFull Name: vacuolar protein sorting 18 homolog (S. cerevisiae)\nCalculated Molecular Weight: 110 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC001513\nGene Symbol: VPS18\nGene ID (NCBI): 57617\nRRID: AB_2882798\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P253\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336064681,"sku":"67590-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67590-1-ig","provider":"Iright","version":"1.0","type":"link"}