{"product_id":"proteintech-67597-1-ig","title":"Proteintech, 67597-1-Ig, Importin Beta Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Importin Beta (67597-1-Ig) by Proteintech is a Monoclonal antibody targeting Importin Beta in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n67597-1-Ig targets Importin Beta in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: IMR-32 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  A549 cells,  Caco-2 cells,  MDA-MB-231 cells,  MOLT-4\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nImportin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23094 Product name: Recombinant human KPNB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 408-605 aa of BC003572 Sequence: QAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISD Predict reactive species\nFull Name: karyopherin (importin) beta 1\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 95-97 kDa\nGenBank Accession Number: BC003572\nGene Symbol: KPNB1\nGene ID (NCBI): 3837\nRRID: AB_2882803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14974\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888065663145,"sku":"67597-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67597-1-ig","provider":"Iright","version":"1.0","type":"link"}