{"product_id":"proteintech-67623-1-ig","title":"Proteintech, 67623-1-Ig, DIS3L2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIS3L2 (67623-1-Ig) by Proteintech is a Monoclonal antibody targeting DIS3L2 in WB, FC (Intra), ELISA applications with reactivity to human, rat samples\n67623-1-Ig targets DIS3L2 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HSC-T6 cells,  LNCaP cells,  Hela cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDIS3L2 encodes a protein of 885 amino acids with a predicted molecular weight of 99.3 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag29992 Product name: Recombinant human DIS3L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-170 aa of BC030113 Sequence: AGALGYRERLDMAPDTLQKQADHCNDSRMASKRVQELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLVEVVLQAEYTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS Predict reactive species\nFull Name: DIS3 mitotic control homolog (S. cerevisiae)-like 2\nCalculated Molecular Weight: 885 aa, 99 kDa\nObserved Molecular Weight: 65 kDa, 99 kda\nGenBank Accession Number: BC030113\nGene Symbol: DIS3L2\nGene ID (NCBI): 129563\nRRID: AB_2882825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IYB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888040202409,"sku":"67623-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67623-1-ig","provider":"Iright","version":"1.0","type":"link"}