{"product_id":"proteintech-67629-1-ig","title":"Proteintech, 67629-1-Ig, PSME3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSME3 (67629-1-Ig) by Proteintech is a Monoclonal antibody targeting PSME3 in WB, IHC, ELISA applications with reactivity to Human, Rat samples\n67629-1-Ig targets PSME3 in WB, IHC, ELISA applications and shows reactivity with Human, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSME3 gene encodes proteasome activator complex subunit 3, which is also called REG-gamma or PA28-gamma. REG-gamma activates the trypsin-like catalytic subunit of the proteasome thus is a proteasome regulator. MDM2-TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of TP53, may be promoted by REG-gamma resulting in inhibited apoptosis after DNA damage. REG-gamma may also be involved in cell cycle regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6716 Product name: Recombinant human PSME3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-254 aa of BC001423 Sequence: MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY Predict reactive species\nFull Name: proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC001423\nGene Symbol: PSME3\nGene ID (NCBI): 10197\nRRID: AB_2882830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P61289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888315453609,"sku":"67629-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67629-1-ig","provider":"Iright","version":"1.0","type":"link"}