{"product_id":"proteintech-67641-1-ig","title":"Proteintech, 67641-1-Ig, BAT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAT1 (67641-1-Ig) by Proteintech is a Monoclonal antibody targeting BAT1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n67641-1-Ig targets BAT1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX39B, is a 428 amino acid protein, which contains one helicase C-terminal domain, one helicase ATP-binding domain and belongs to the DEAD box helicase family. DECD subfamily.  DDX39B localizes in the nucleus and cytoplasm. BAT1 is involved in nuclear export of spliced and unspliced mRNA. BAT1 as ATP dependent RNA helicase, may be a translation initiation factor and acts as a negative regulator of inflammatory cytokines. This antibody may cross-react with DDX39A.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6612 Product name: Recombinant human BAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-428 aa of BC000361 Sequence: ILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR Predict reactive species\nFull Name: HLA-B associated transcript 1\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC000361\nGene Symbol: BAT1\nGene ID (NCBI): 7919\nRRID: AB_2882841\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13838\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888102068393,"sku":"67641-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67641-1-ig","provider":"Iright","version":"1.0","type":"link"}