{"product_id":"proteintech-67656-1-ig","title":"Proteintech, 67656-1-Ig, CYR61\/CCN1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYR61\/CCN1 (67656-1-Ig) by Proteintech is a Monoclonal antibody targeting CYR61\/CCN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n67656-1-Ig targets CYR61\/CCN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, A431 cells,  PC-3 cells,  HeLa cells,  MDA-MB-231 cells\nPositive IHC detected in: human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species\nFull Name: cysteine-rich, angiogenic inducer, 61\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 40-42 kDa\nGenBank Accession Number: BC001271\nGene Symbol: CYR61\nGene ID (NCBI): 3491\nRRID: AB_2882854\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00622\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888010088617,"sku":"67656-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67656-1-ig","provider":"Iright","version":"1.0","type":"link"}