{"product_id":"proteintech-67657-1-ig","title":"Proteintech, 67657-1-Ig, Destrin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Destrin (67657-1-Ig) by Proteintech is a Monoclonal antibody targeting Destrin in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n67657-1-Ig targets Destrin in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  human platelet,  pig rectum,  rat rectum,  pig brain,  rat brain,  mouse brain\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:3000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDestrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1402 Product name: Recombinant human DSTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009477 Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV Predict reactive species\nFull Name: destrin (actin depolymerizing factor)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 18-19 kDa\nGenBank Accession Number: BC009477\nGene Symbol: Destrin\nGene ID (NCBI): 11034\nRRID: AB_2918496\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P60981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060911785,"sku":"67657-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67657-1-ig","provider":"Iright","version":"1.0","type":"link"}