{"product_id":"proteintech-67662-1-ig","title":"Proteintech, 67662-1-Ig, HARS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HARS (67662-1-Ig) by Proteintech is a Monoclonal antibody targeting HARS in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67662-1-Ig targets HARS in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NIH\/3T3 cells,  HSC-T6 cells,  Jurkat cells,  HEK-293 cells,  HepG2 cells,  HeLa cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHARS is a cytoplasmic enzyme that belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. HARS is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis\/dermatomyositis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9224 Product name: Recombinant human HARS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-282 aa of BC011807 Sequence: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQ Predict reactive species\nFull Name: histidyl-tRNA synthetase\nCalculated Molecular Weight: 509 aa, 57 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC011807\nGene Symbol: HARS\nGene ID (NCBI): 3035\nRRID: AB_2882859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P12081\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888282095785,"sku":"67662-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67662-1-ig","provider":"Iright","version":"1.0","type":"link"}