{"product_id":"proteintech-67680-1-ig","title":"Proteintech, 67680-1-Ig, NXT1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NXT1 (67680-1-Ig) by Proteintech is a Monoclonal antibody targeting NXT1 in WB, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n67680-1-Ig targets NXT1 in WB, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  HepG2 cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNXT1 is located in the nuclear envelope and is homologous to nuclear transport factor 2. NXT1 functions as a nuclear export factor in both \tRAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. NXT1 also heterodimerizes with Tap protein and regulates the ability of Tap protein to mediate nuclear mRNA export.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30039 Product name: Recombinant human NXT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC000759 Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS Predict reactive species\nFull Name: NTF2-like export factor 1\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC000759\nGene Symbol: NXT1\nGene ID (NCBI): 29107\nRRID: AB_2882873\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UKK6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888046887081,"sku":"67680-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67680-1-ig","provider":"Iright","version":"1.0","type":"link"}