{"product_id":"proteintech-67689-1-ig","title":"Proteintech, 67689-1-Ig, ALPK1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALPK1 (67689-1-Ig) by Proteintech is a Monoclonal antibody targeting ALPK1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n67689-1-Ig targets ALPK1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, T-47D cells,  A549 cells,  U-87 MG cells,  Daudi cells,  THP-1 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-protein kinase 1, also known as alpha-kinase 1 (ALPK1), is associated with chronic kidney disease (CKD), myocardial infarction, gout and type 2 diabetes mellitus (DM). ALPK1 mutant has been reported to cause severe defects in motor co‐ordination in mice. ALPK1 enhances the expression of proinflammatory cytokines including IL-1β, IL-8 and TGF-β1 in cultured human THP1 and human embryonic kidney 293 (HEK293) cells (PMID: 31557402, PMID: 26275947). ALPK1 short isoform (108 kDa) was highly expressed in brain, spinal cord, heart, lung, spleen, thymus, small intestine, skin and testis, while detectable inskeletal muscle and kidney. ALPK1 large isoform (130 kDa) appeared in heart, lung, thymus and skin (PMID: 21208416).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5320 Product name: Recombinant human ALPK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-347 aa of BC060780 Sequence: MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTG Predict reactive species\nFull Name: alpha-kinase 1\nCalculated Molecular Weight: 139 kDa\nObserved Molecular Weight: 139 kDa\nGenBank Accession Number: BC060780\nGene Symbol: ALPK1\nGene ID (NCBI): 80216\nRRID: AB_2882882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q96QP1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888052981929,"sku":"67689-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67689-1-ig","provider":"Iright","version":"1.0","type":"link"}