{"product_id":"proteintech-67691-1-ig","title":"Proteintech, 67691-1-Ig, FABP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP2 (67691-1-Ig) by Proteintech is a Monoclonal antibody targeting FABP2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n67691-1-Ig targets FABP2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat small intestine tissue, human jejunum tissue,  COLO 320 cells,  pig duodenum,  mouse small intestine,  rabbit small intestine\nPositive IHC detected in: mouse small intestine tissue, mouse colon tissue,  rat small intestine tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:50000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villus cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17620 Product name: Recombinant human FABP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-132 aa of BC069617 Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Predict reactive species\nFull Name: fatty acid binding protein 2, intestinal\nCalculated Molecular Weight: 132 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC069617\nGene Symbol: FABP2\nGene ID (NCBI): 2169\nRRID: AB_2882884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P12104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888027947177,"sku":"67691-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67691-1-ig","provider":"Iright","version":"1.0","type":"link"}