{"product_id":"proteintech-67697-1-ig","title":"Proteintech, 67697-1-Ig, FBXO6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO6 (67697-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO6 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67697-1-Ig targets FBXO6 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  MOLT-4 cells,  K-562 cells,  U-937 cells,  RAW 264.7 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. FBXO6 is the substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs. Positive Fbxo6 expression correlated with early TNM stage and favorable prognosis of NSCLC patients. (PMID:19716789, PMID: 27855403, PMID: 31140586).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30512 Product name: Recombinant human FBXO6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-293 aa of BC020880 Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF Predict reactive species\nFull Name: F-box protein 6\nCalculated Molecular Weight: 293 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC020880\nGene Symbol: FBXO6\nGene ID (NCBI): 26270\nRRID: AB_2882889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NRD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041545897,"sku":"67697-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67697-1-ig","provider":"Iright","version":"1.0","type":"link"}