{"product_id":"proteintech-67710-1-ig","title":"Proteintech, 67710-1-Ig, TNC\/Tenascin-C Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNC\/Tenascin-C (67710-1-Ig) by Proteintech is a Monoclonal antibody targeting TNC\/Tenascin-C in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67710-1-Ig targets TNC\/Tenascin-C in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, HEK-293 cells,  rat cerebellum tissue,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissue, human liver cancer tissue,  human lung cancer tissue,  mouse brain tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21412 Product name: Recombinant human TNC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1852-2201 aa of BC151843 Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA Predict reactive species\nFull Name: tenascin C\nCalculated Molecular Weight: 2201 aa, 241 kDa\nObserved Molecular Weight: 260 kDa\nGenBank Accession Number: BC151843\nGene Symbol: Tenascin C\nGene ID (NCBI): 3371\nRRID: AB_2882900\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P24821\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991378089,"sku":"67710-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67710-1-ig","provider":"Iright","version":"1.0","type":"link"}