{"product_id":"proteintech-67714-1-ig","title":"Proteintech, 67714-1-Ig, RHAG Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHAG (67714-1-Ig) by Proteintech is a Monoclonal antibody targeting RHAG in WB, IHC, IF-P, ELISA applications with reactivity to Human samples\n67714-1-Ig targets RHAG in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30130 Product name: Recombinant human RHAG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-53 aa of BC012605 Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPL Predict reactive species\nFull Name: Rh-associated glycoprotein\nCalculated Molecular Weight: 409 aa, 44 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC012605\nGene Symbol: RHAG\nGene ID (NCBI): 6005\nRRID: AB_2882904\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q02094\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888318861481,"sku":"67714-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67714-1-ig","provider":"Iright","version":"1.0","type":"link"}