{"product_id":"proteintech-67723-1-ig","title":"Proteintech, 67723-1-Ig, PSIP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSIP1 (67723-1-Ig) by Proteintech is a Monoclonal antibody targeting PSIP1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n67723-1-Ig targets PSIP1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, Jurkat cells,  U2OS cells,  NIH\/3T3 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  K-562 cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSIP1, also known as PC4 and SRSF1 Interacting Protein 1 or Lens Epithelium-Derived Growth Factor (LEDGF), is a transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis.  It also plays a role in lens epithelial cell gene regulation and stress responses. It is a chromatin-associated protein with histone chaperone activity, involved in transcriptional elongation. PSIP1 may act as an adapter to coordinate pre-mRNA splicing. PSIP1 encodes two protein isoforms with molecular masses of 52 and 75 kDa. p52 and p75 were identified as interacting with transcription factor PC4 and shown to act as transcriptional coactivators.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30562 Product name: Recombinant human PSIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-325 aa of NM_021144 Sequence: ASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETE Predict reactive species\nFull Name: PC4 and SFRS1 interacting protein 1\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_021144\nGene Symbol: PSIP1\nGene ID (NCBI): 11168\nRRID: AB_3670379\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75475\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888314437801,"sku":"67723-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-67723-1-ig","provider":"Iright","version":"1.0","type":"link"}